Китайски производител на анаболни стероиди на прах
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнська

Фармацевтични пептиди

» Пептиди » Фармацевтични пептиди

  • Спецификации
  • Описание на продукта
  • Използване на продукта

Име: Sermorelin Acetate

Cas No: 86168-78-7(нето),114466-38-5(ацетат)

Формула: C151H250N44O44S

Молекулярна:3417

Последователност: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

Чистота:98%

Външен вид: бял прах

Източник: синтетичен

Известен също като: Реф, НЯКОИ-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Марка Serono на Sermorelin, Серморелина, Серморелин, Реф (TN), Sermoreline [френски].

Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 аминокиселинни остатъци. It stimulates the pituitary gland to naturally produce increased amounts of human growth hormone.

Sermorelin Acetate is a truncated analog of a growth hormone releasing factor (GRF 1-44) that is naturally produced by the brain to stimulate pituitary production of human growth hormone. The increased volume of human growth hormone (hGH) produced by the pituitary gland causes an increase in the production of Insulin-Like Growth Factor-1 (IGF-1) by the liver and results in the benefits of treatment provided to the adult patient.

The purpose of adult Sermorelin growth hormone therapy is to reverse the effects of aging and secure the extensive treatment benefits described below.

Even though in bodybuilding circles we don't hear much about Sermorelin, this doesn't mean that this peptide does not have its uses. Всъщност, anti-aging and hormone replacement clinics have been prescribing it for years because it works as a clean GHRH. The problem for the bodybuilder or athlete is that it has a very short half-life of about ten (10) минути. This becomes an unattractive feature when compared to the half-life of MOD GRF (1-29) (CJC 1295 without DAC), which comes in around 30 минути. Despite its short window, it does bind quite effectively to the pituitary receptors. The other main down side associated with its very short half life is that it is quickly broken down by blood enzymes within minutes. This is why a GHRH peptide with a half life of 30 minutes or longer is desirable, since it will survive the blood enzyme death and allow it to circulate the body looking for hormone receptors to bind to.

Форма за запитване ( ние ще ви върнем възможно най-скоро )

Име:
*
Имейл:
*
Съобщение:

Проверка:
5 + 6 = ?

Може би ви харесва също

  • Продуктови категории

  • Нашето предимство

    Добра цена

    Високо качество

    Бърза доставка

    Безопасна доставка

    Отлично следпродажбено обслужване

  • Локален склад

    ЕС склад

    Склад във Великобритания

    Склад в САЩ

    Канадски склад

    Австралийски склад

  • Начин на плащане

    Paypal

    Биткойн

    Банков превод

    Money Gram

    Western Union

  • Свържете се с нас

    Имейл: jacob@steroid-peptide.com

    WhatsApp: +8615636286252

    Телефон: 0086-15636286252

    уебсайт: www.steroid-peptide.com

    Приветстваме вашето запитване

  • Обслужване