نام: سرمورلین استات
Cas No: 86168-78-7(خالص),114466-38-5(استات)
فرمول: C151H250N44O44S
مولکولی:3417
دنباله: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
خلوص:98%
ظاهر: پودر سفید
منبع: مصنوعی
همچنین به عنوان شناخته شده است: رفر, برخی از-00IBG87IQW,AN-33322، GRF(1-29), GHRH(1-29), برند سرونو سرمورلین, سرمورلینا, سرمورلینوم, رفر (TN), Sermoreline [فرانسوی].
Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It stimulates the pituitary gland to naturally produce increased amounts of human growth hormone.
Sermorelin Acetate is a truncated analog of a growth hormone releasing factor (GRF 1-44) that is naturally produced by the brain to stimulate pituitary production of human growth hormone. The increased volume of human growth hormone (hGH) produced by the pituitary gland causes an increase in the production of Insulin-Like Growth Factor-1 (IGF-1) by the liver and results in the benefits of treatment provided to the adult patient.
The purpose of adult Sermorelin growth hormone therapy is to reverse the effects of aging and secure the extensive treatment benefits described below.
Even though in bodybuilding circles we don't hear much about Sermorelin, this doesn't mean that this peptide does not have its uses. در واقع, anti-aging and hormone replacement clinics have been prescribing it for years because it works as a clean GHRH. The problem for the bodybuilder or athlete is that it has a very short half-life of about ten (10) دقیقه. در مقایسه با نیمه عمر MOD GRF، این ویژگی غیرجذاب می شود (1-29) (CJC 1295 بدون DAC), که در اطراف می آید 30 دقیقه. با وجود پنجره کوتاهش, به طور موثری به گیرنده های هیپوفیز متصل می شود. جنبه منفی دیگر مربوط به نیمه عمر بسیار کوتاه آن این است که به سرعت توسط آنزیم های خون در عرض چند دقیقه تجزیه می شود. به همین دلیل است که یک پپتید GHRH با نیمه عمر 30 دقیقه یا بیشتر مطلوب است, زیرا از مرگ آنزیم خون جان سالم به در میبرد و به آن اجازه میدهد بدن را به دنبال گیرندههای هورمونی برای اتصال به بدن گردش کند..