Chine Fabricant de poudre de stéroïdes anabolisants
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнська

Peptides pharmaceutiques

» Peptides » Peptides pharmaceutiques

  • Caractéristiques
  • Description du produit
  • Utilisation du produit

Nom du produit: FOXO4-DRI
Nom commercial:Proxofim
Formule moléculaire: C228H388N86O64
Poids moléculaire: 5358.05 g/mole
Spécification: 1mg/flacons
Pureté : 98% HPLC
Apparence: Poudre lyophilisée blanche
Utilisation typique:Anti-aging Weight loss
Emballage standard : 10flacons/kits
Durée de conservation:6 Month
Stockage:Température ambiante à l'abri de la lumière

Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

FOXO4-DRI is a synthetic version of FOXO4, which contains D amino acids instead of L amino acids. This modification allows it to retain the functionality of the original protein and longer shelf life, and lower clearance from the body. Its most prominent function is the regulation of apoptosis in senescent cells. It inhibits FOXO4-p53 binding. Thus p53 can target pro-apoptotic genes and promote their expression. These proteins, à son tour, bring about apoptosis of old cells, thereby reducing the old cell burden in tissues. This increases cellular differentiation and tissue repair,
and regrowth and decrease in “biological age.”

FOXO4 is known to help the perpetuation of aged or senescent cells.It binds to p53 and thereby prevents apoptotic death of the senescent cells. The DRI peptide prevents FOXO4-p53 interaction.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Formulaire de demande ( nous vous répondrons dans les plus brefs délais )

Nom:
*
E-mail:
*
Message:

Vérification:
3 + 5 = ?

Peut-être que tu aimes aussi

  • Notre avantage

    Bon prix

    Haute qualité

    Livraison rapide

    Expédition sécurisée

    Excellent service après-vente

  • Entrepôt local

    Entrepôt UE

    Entrepôt au Royaume-Uni

    Entrepôt aux États-Unis

    Entrepôt canadien

    Entrepôt en Australie

  • Mode de paiement

    Paypal

    Bitcoin

    Virement bancaire

    Paiement de Petit Montant

    Western union

  • Contactez-nous

    E-mail: jacob@steroid-peptide.com

    WhatsApp: +8615636286252

    Téléphone: 0086-15636286252

    Site web: www.steroid-peptide.com

    Bienvenue votre demande