China Anabole steroïdenpoederfabrikant
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнська

Farmaceutische peptiden

» Peptiden » Farmaceutische peptiden

  • Specificaties
  • Productbeschrijving
  • Productgebruik

Productnaam: FOXO4-DRI
Handelsnaam:Proxofim
Moleculaire formule: C228H388N86O64
Moleculair gewicht: 5358.05 g/mol
Specifition: 1mg/Vials
Zuiverheid : 98% HPLC
Verschijning: Wit gevriesdroogd poeder
Typisch gebruik:Anti-aging Weight loss
Standard Packing : 10vials/kits
Houdbaarheid:6 Month
Opslag:Kamertemperatuur weg van licht

Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

FOXO4-DRI is a synthetic version of FOXO4, which contains D amino acids instead of L amino acids. This modification allows it to retain the functionality of the original protein and longer shelf life, and lower clearance from the body. Its most prominent function is the regulation of apoptosis in senescent cells. It inhibits FOXO4-p53 binding. Thus p53 can target pro-apoptotic genes and promote their expression. These proteins, op zijn beurt, bring about apoptosis of old cells, thereby reducing the old cell burden in tissues. This increases cellular differentiation and tissue repair,
and regrowth and decrease in “biological age.”

FOXO4 is known to help the perpetuation of aged or senescent cells.It binds to p53 and thereby prevents apoptotic death of the senescent cells. The DRI peptide prevents FOXO4-p53 interaction.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Aanvraagformulier ( wij nemen zo snel mogelijk contact met u op )

Naam:
*
E-mail:
*
Bericht:

Verificatie:
3 + 8 = ?

Misschien vind jij het ook leuk

  • Ons voordeel

    Goede prijs

    Hoge kwaliteit

    Snelle levering

    Veilige verzending

    Uitstekende service na verkoop

  • Lokaal magazijn

    EU-magazijn

    Brits magazijn

    Amerikaans magazijn

    Canada magazijn

    Australië magazijn

  • Betaalmethode

    Paypal

    Bitcoin

    Bankoverschrijving

    Geldgram

    Western Unie

  • Neem contact met ons op

    E-mail: jacob@steroïde-peptide.com

    WhatsAppen: +8615636286252

    Telefoon: 0086-15636286252

    Website: www.steroïde-peptide.com

    Stem in met uw onderzoek