Čínsky výrobca prášku anabolických steroidov
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнська

Farmaceutické peptidy

» Peptidy » Farmaceutické peptidy

  • Špecifikácie
  • Popis produktu
  • Použitie produktu

Názov produktu: FOXO4-DRI
obchodné meno:Proxofim
Molekulový vzorec: C228H388N86O64
Molekulová hmotnosť: 5358.05 g/mol
Specifition: 1mg/Vials
Čistota : 98% HPLC
Vzhľad: White Lyophilized Powder
Typické použitie:Anti-aging Weight loss
Standard Packing : 10vials/kits
Shelf Life:6 Month
Skladovanie:Izbová teplota mimo dosahu svetla

Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

FOXO4-DRI is a synthetic version of FOXO4, which contains D amino acids instead of L amino acids. This modification allows it to retain the functionality of the original protein and longer shelf life, and lower clearance from the body. Its most prominent function is the regulation of apoptosis in senescent cells. It inhibits FOXO4-p53 binding. Thus p53 can target pro-apoptotic genes and promote their expression. These proteins, v poradí, bring about apoptosis of old cells, thereby reducing the old cell burden in tissues. This increases cellular differentiation and tissue repair,
and regrowth and decrease in “biological age.”

FOXO4 is known to help the perpetuation of aged or senescent cells.It binds to p53 and thereby prevents apoptotic death of the senescent cells. The DRI peptide prevents FOXO4-p53 interaction.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Formulár dopytu ( ozveme sa vám čo najskôr )

Meno:
*
Email:
*
Správa:

Overenie:
5 + 7 = ?

Možno sa páči aj vám

  • Naša výhoda

    Dobrá cena

    Vysoká kvalita

    Rýchle doručenie

    Bezpečná zásielka

    Vynikajúci servis po predaji

  • Miestny sklad

    EU sklad

    UK sklad

    USA sklad

    Kanadský sklad

    Austrálsky sklad

  • Spôsob platby

    Paypal

    Bitcoin

    Bankový prevod

    Money Gram

    Western Union

  • Kontaktujte nás

    Email: jacob@steroid-peptide.com

    WhatsApp: +8615636286252

    Telefón: 0086-15636286252

    webové stránky: www.steroid-peptide.com

    Vítame váš dopyt