Fabricante de polvo de esteroides anabólicos de China
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнська

Péptidos farmacéuticos

» Péptidos » Péptidos farmacéuticos

  • Presupuesto
  • Descripción del Producto
  • Uso del producto

Nombre del producto: FOXO4-DRI
Nombre comercial:Proxofim
Fórmula molecular: C228H388N86O64
Peso molecular: 5358.05 g/mol
Especificación: 1mg/viales
Pureza : 98% HPLC
Apariencia: Polvo Liofilizado Blanco
Uso típico:Anti-aging Weight loss
Embalaje estándar : 10viales/kits
Duración:6 Month
Almacenamiento:Temperatura ambiente alejada de la luz.

Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

FOXO4-DRI is a synthetic version of FOXO4, which contains D amino acids instead of L amino acids. This modification allows it to retain the functionality of the original protein and longer shelf life, and lower clearance from the body. Its most prominent function is the regulation of apoptosis in senescent cells. It inhibits FOXO4-p53 binding. Thus p53 can target pro-apoptotic genes and promote their expression. These proteins, Sucesivamente, bring about apoptosis of old cells, thereby reducing the old cell burden in tissues. This increases cellular differentiation and tissue repair,
and regrowth and decrease in “biological age.”

FOXO4 is known to help the perpetuation of aged or senescent cells.It binds to p53 and thereby prevents apoptotic death of the senescent cells. The DRI peptide prevents FOXO4-p53 interaction.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Formulario de consulta ( Te responderemos lo antes posible. )

Nombre:
*
Correo electrónico:
*
Mensaje:

Verificación:
0 + 7 = ?

Quizás a ti también te guste

  • Nuestra ventaja

    Buen precio

    Alta calidad

    Entrega rápida

    Envío seguro

    Excelente servicio postventa

  • Almacén Local

    Almacén de la UE

    Almacén del Reino Unido

    Almacén de EE. UU.

    Almacén de Canadá

    Almacén de Australia

  • Método de pago

    PayPal

    bitcóin

    Transferencia bancaria

    gramo de dinero

    Western Union

  • Contáctenos

    Correo electrónico: jacob@steroid-peptide.com

    WhatsApp: +8615636286252

    Teléfono: 0086-15636286252

    Sitio web: www.steroid-peptide.com

    Bienvenido a su consulta

  • Servicio