Kitajski proizvajalec anaboličnih steroidov v prahu
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнська

Farmacevtski peptidi

» Peptidi » Farmacevtski peptidi

  • Specifikacije
  • Opis izdelka
  • Uporaba izdelka

Ime izdelka: FOXO4-DRI
Trade Name:Proxofim
Molekularna formula: C228H388N86O64
Molekulska teža: 5358.05 g/mol
Specifikacija: 1mg/Vials
Čistost : 98% HPLC
Videz: White Lyophilized Powder
Tipična uporaba:Anti-aging Weight loss
Standard Packing : 10vials/kits
Rok trajanja:6 Month
Shranjevanje:Sobna temperatura stran od svetlobe

Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

FOXO4-DRI is a synthetic version of FOXO4, which contains D amino acids instead of L amino acids. This modification allows it to retain the functionality of the original protein and longer shelf life, and lower clearance from the body. Its most prominent function is the regulation of apoptosis in senescent cells. It inhibits FOXO4-p53 binding. Thus p53 can target pro-apoptotic genes and promote their expression. These proteins, in turn, bring about apoptosis of old cells, thereby reducing the old cell burden in tissues. This increases cellular differentiation and tissue repair,
and regrowth and decrease in “biological age.”

FOXO4 is known to help the perpetuation of aged or senescent cells.It binds to p53 and thereby prevents apoptotic death of the senescent cells. The DRI peptide prevents FOXO4-p53 interaction.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Obrazec za povpraševanje ( vrnili vam bomo v najkrajšem možnem času )

Ime:
*
E-pošta:
*
Sporočilo:

Preverjanje:
5 + 3 = ?

Mogoče vam je tudi všeč

  • Naša prednost

    Dobra cena

    Visoka kakovost

    Hitra dostava

    Varna pošiljka

    Odlična poprodajna storitev

  • Lokalno skladišče

    EU skladišče

    Skladišče v Združenem kraljestvu

    Skladišče ZDA

    Kanadsko skladišče

    Avstralsko skladišče

  • Način plačila

    Paypal

    Bitcoin

    Bančno nakazilo

    Money Gram

    Western Union

  • Kontaktirajte nas

    E-pošta: jacob@steroid-peptide.com

    WhatsApp: +8615636286252

    Telefon: 0086-15636286252

    Spletna stran: www.steroid-peptide.com

    Pozdravljamo vaše povpraševanje

  • Storitev