Ürün Adı: FOXO4-DRI
Trade Name:Proxofim
Moleküler Formül: C228H388N86O64
Molekül Ağırlığı: 5358.05 g/mol
Specifition: 1mg/Vials
Saflık : 98% HPLC
Dış görünüş: Beyaz Liyofilize Toz
Tipik kullanım:Anti-aging Weight loss
Standard Packing : 10vials/kits
Raf ömrü:6 Month
Depolamak:Oda sıcaklığında ışıktan uzak
Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
FOXO4-DRI is a synthetic version of FOXO4, which contains D amino acids instead of L amino acids. This modification allows it to retain the functionality of the original protein and longer shelf life, and lower clearance from the body. Its most prominent function is the regulation of apoptosis in senescent cells. It inhibits FOXO4-p53 binding. Thus p53 can target pro-apoptotic genes and promote their expression. These proteins, sırayla, bring about apoptosis of old cells, thereby reducing the old cell burden in tissues. This increases cellular differentiation and tissue repair,
and regrowth and decrease in “biological age.”
FOXO4 is known to help the perpetuation of aged or senescent cells.It binds to p53 and thereby prevents apoptotic death of the senescent cells. The DRI peptide prevents FOXO4-p53 interaction.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice